PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7128s0570.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family TALE
Protein Properties Length: 536aa    MW: 60082.6 Da    PI: 5.9701
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7128s0570.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.4e-103704071954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  Bostr.7128s0570.1.p 370 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 407
                          664459******************************88 PP

2BELL121.92.8e-39230301172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          er+elq+kk+kLl++++eVdkrY+qy++q+++++ssFe+vaglgsakpYts+Al++iSrhFr+L+dai+eqi
  Bostr.7128s0570.1.p 230 EREELQNKKNKLLTMVDEVDKRYNQYYHQMEALASSFEIVAGLGSAKPYTSVALNRISRHFRALRDAIKEQI 301
                          799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-51156299IPR006563POX domain
PfamPF075261.3E-46162297IPR006563POX domain
PROSITE profilePS5007112.455348411IPR001356Homeobox domain
CDDcd000869.93E-12351412No hitNo description
SMARTSM003895.4E-10351415IPR001356Homeobox domain
SuperFamilySSF466891.71E-17352418IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28354417IPR009057Homeodomain-like
PfamPF059206.7E-18368407IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MAVYYPSNVG CYQQEPIFLN HLQQQASSSS AAASFAATGG DNVRNEMVFI PPTTGDVVTG  60
NGAVSSSDLS FHDGQGLSLS LGTQISVPPF QYHQYQLGFT QNPSLSVKET STFNVDEMSV  120
KSKEMLLLGQ SDPSSGYAGN GGIGFYNNYR YNETSGGFMS GVLRSRYLKP AQNLLDEVVS  180
VKKELNQMGK KKMKVNDFNN GSKEIEGGGG GSGELSSDSN GKAIELSTIE REELQNKKNK  240
LLTMVDEVDK RYNQYYHQME ALASSFEIVA GLGSAKPYTS VALNRISRHF RALRDAIKEQ  300
IQIIRDKLGE KGGESSDEQQ GERIPRLRYL DQRLRQQRAL HQQLGMVRPA WRPQRGLPEN  360
SVSVLRAWLF EHFLHPYPKE SEKIMLAKQT GLSKNQVANW FINARVRLWK PMIEEMYKEE  420
FGDESELLIS KSSQEPNSTN QEDSSSQQHQ QENNNNNLTY SSVDTTNIAF SSEIKPDRVS  480
GNDDEPQQQQ MNRSADYDTL MNYQGFGLDD YRYIGGSNQQ ESRFSNSHHL HDFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B3e-16357414158Homeobox protein Meis1
4xrs_A3e-16357414158Homeobox protein Meis1
3k2a_B4e-16357415563Homeobox protein Meis2
3k2a_A4e-16357415563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5705080.0AY570508.1 Arabidopsis thaliana BEL1-like homeodomain 5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006307208.10.0hypothetical protein CARUB_v10008805mg
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLR0GWD70.0R0GWD7_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.1__2150__AT1G19700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10